PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000793.1_g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 352aa    MW: 40225.8 Da    PI: 5.9883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000793.1_g00021.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.2e-5691361128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv +yLk+k++g+++el +vi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWk
  Itr_sc000793.1_g00021.1   9 LPPGFRFHPTDEELVAYYLKRKINGHRIEL-DVIPEVDLYKCEPWDLPgKaLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWK 93 
                              79****************************.9****************6434555777**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v s + ++vg+kktLv+++grap+g +tdW+mheyrl
  Itr_sc000793.1_g00021.1  94 ATGKDRKVNS-EMRAVGMKKTLVYHRGRAPHGARTDWIMHEYRL 136
                              *********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-643159IPR003441NAC domain
PROSITE profilePS5100561.0979159IPR003441NAC domain
PfamPF023657.2E-3010136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEAMATVSLP PGFRFHPTDE ELVAYYLKRK INGHRIELDV IPEVDLYKCE PWDLPGKALL  60
PSKDLEWYFF SPRDRKYPNG SRTNRATKAG YWKATGKDRK VNSEMRAVGM KKTLVYHRGR  120
APHGARTDWI MHEYRLDERE CETRSGLQEA YALCRIFKKS LNGLKIGENS GADRSSYDYE  180
TESSTYAMAA PSSSATCSSP MTAAAGDGSL FNFPGGVSSD HRYWMQFLSS DDQAFRFHNN  240
PSHRFMLPPV EFHQSSFVPE YANHDEILSV HHQHQHQAAS GFSDDYFPFV PQNNEELGDM  300
DSSLITEQLN QDDQQNVGEE LRSDRMVENL RWVGVLDKDI EKVILDHSAI LV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-59215910165NO APICAL MERISTEM PROTEIN
1ut4_B8e-59215910165NO APICAL MERISTEM PROTEIN
1ut7_A8e-59215910165NO APICAL MERISTEM PROTEIN
1ut7_B8e-59215910165NO APICAL MERISTEM PROTEIN
3swm_A8e-59215913168NAC domain-containing protein 19
3swm_B8e-59215913168NAC domain-containing protein 19
3swm_C8e-59215913168NAC domain-containing protein 19
3swm_D8e-59215913168NAC domain-containing protein 19
3swp_A8e-59215913168NAC domain-containing protein 19
3swp_B8e-59215913168NAC domain-containing protein 19
3swp_C8e-59215913168NAC domain-containing protein 19
3swp_D8e-59215913168NAC domain-containing protein 19
4dul_A8e-59215910165NAC domain-containing protein 19
4dul_B8e-59215910165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625360.11e-130PREDICTED: uncharacterized protein LOC104116251
RefseqXP_016489725.11e-130PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI54e-95NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A068U2961e-126A0A068U296_COFCA; Uncharacterized protein
TrEMBLM1BXQ91e-126M1BXQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000553221e-125(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-102NAC domain containing protein 28